Web Analysis for Thebeautyandabeet - thebeautyandabeet.com
4.70
Rating by CuteStat
thebeautyandabeet.com is 5 years 1 month old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, thebeautyandabeet.com is SAFE to browse.
PageSpeed Score
88
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | 4 |
H3 Headings: | 3 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 7 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 104.248.233.180)
Rathfarnham Appliance Repairs | Boiler Repairs | Dublin
- rathfarnhamappliances.site
Rathfarnham Appliance Repairs specialise in all domestic appliance repairs based in Dublin. Call us today.
Not Applicable
$
8.95
Walmsley appliance repair services | kitchen appliance repairs | Showe
- walmsleyapplianceservices.site
Welcome to Walmsley Appliance Services. All brands of electrical home appliances repaired Tel: 098 28814 For appliance repairs and shower repairs accross Mayo
Not Applicable
$
8.95
Auto Repair Tucson | Mechanic Arizona | Car Repair 85751- Milex Auto S
- milexauto.site
Milex Auto Repair Services offers a multitude of services to keep your car in the best possible condition. Call us and schedule an appointment today!
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
X-Powered-By: PHP/5.5.9-1ubuntu4.27
Content-type: text/html
Transfer-Encoding: chunked
Date: Thu, 04 Apr 2019 13:33:49 GMT
Server: lighttpd/1.4.33
X-Powered-By: PHP/5.5.9-1ubuntu4.27
Content-type: text/html
Transfer-Encoding: chunked
Date: Thu, 04 Apr 2019 13:33:49 GMT
Server: lighttpd/1.4.33
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
dns1.registrar-servers.com | 156.154.132.200 | United States of America | |
dns2.registrar-servers.com | 156.154.133.200 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
thebeautyandabeet.com | A | 59 |
IP: 104.248.233.180 |
thebeautyandabeet.com | NS | 1800 |
Target: dns2.registrar-servers.com |
thebeautyandabeet.com | NS | 1800 |
Target: dns1.registrar-servers.com |
thebeautyandabeet.com | SOA | 3600 |
MNAME: dns1.registrar-servers.com RNAME: hostmaster.registrar-servers.com Serial: 2019040202 Refresh: 43200 Retry: 3600 Expire: 604800 Minimum TTL: 3601 |
thebeautyandabeet.com | MX | 1800 |
Priority: 10 Target: eforward1.registrar-servers.com |
thebeautyandabeet.com | MX | 1800 |
Priority: 10 Target: eforward2.registrar-servers.com |
thebeautyandabeet.com | MX | 1800 |
Priority: 10 Target: eforward3.registrar-servers.com |
thebeautyandabeet.com | MX | 1800 |
Priority: 15 Target: eforward4.registrar-servers.com |
thebeautyandabeet.com | MX | 1800 |
Priority: 20 Target: eforward5.registrar-servers.com |
thebeautyandabeet.com | TXT | 1800 |
TXT: v=spf1 include:spf.efwd.registrar-servers.com ~all |
Full WHOIS Lookup
Domain Name: THEBEAUTYANDABEET.COM
Registry Domain ID: 2376106649_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2019-04-02T19:49:05Z
Creation Date: 2019-04-02T19:48:57Z
Registry Expiry Date: 2020-04-02T19:48:57Z
Registrar: NameCheap, Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DNS1.REGISTRAR-SERVERS.COM
Name Server: DNS2.REGISTRAR-SERVERS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-04-04T13:33:38Z
Registry Domain ID: 2376106649_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2019-04-02T19:49:05Z
Creation Date: 2019-04-02T19:48:57Z
Registry Expiry Date: 2020-04-02T19:48:57Z
Registrar: NameCheap, Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DNS1.REGISTRAR-SERVERS.COM
Name Server: DNS2.REGISTRAR-SERVERS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-04-04T13:33:38Z