4.70 Rating by CuteStat

thebeautyandabeet.com is 5 years 1 month old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, thebeautyandabeet.com is SAFE to browse.

PageSpeed Score
88
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.248.233.180

Hosted Country:

United States of America US

Location Latitude:

40.793

Location Longitude:

-74.0247

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 4
H3 Headings: 3 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 7
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 104.248.233.180)

Appliancefix.ie

- appliancefix.site
Not Applicable $ 8.95

Rathfarnham Appliance Repairs | Boiler Repairs | Dublin

- rathfarnhamappliances.site

Rathfarnham Appliance Repairs specialise in all domestic appliance repairs based in Dublin. Call us today.

Not Applicable $ 8.95

Walmsley appliance repair services | kitchen appliance repairs | Showe

- walmsleyapplianceservices.site

Welcome to Walmsley Appliance Services. All brands of electrical home appliances repaired Tel: 098 28814 For appliance repairs and shower repairs accross Mayo

Not Applicable $ 8.95

Electrical Retailer Tiverton

- clarkeselectrical.site
Not Applicable $ 8.95

Auto Repair Tucson | Mechanic Arizona | Car Repair 85751- Milex Auto S

- milexauto.site

Milex Auto Repair Services offers a multitude of services to keep your car in the best possible condition. Call us and schedule an appointment today!

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
X-Powered-By: PHP/5.5.9-1ubuntu4.27
Content-type: text/html
Transfer-Encoding: chunked
Date: Thu, 04 Apr 2019 13:33:49 GMT
Server: lighttpd/1.4.33

Domain Information

Domain Registrar: NAMECHEAP INC
Registration Date: Apr 2, 2019, 12:00 AM 5 years 1 month 1 week ago
Last Modified: Apr 2, 2019, 12:00 AM 5 years 1 month 1 week ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
dns1.registrar-servers.com 156.154.132.200 United States of America United States of America
dns2.registrar-servers.com 156.154.133.200 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
thebeautyandabeet.com A 59 IP: 104.248.233.180
thebeautyandabeet.com NS 1800 Target: dns2.registrar-servers.com
thebeautyandabeet.com NS 1800 Target: dns1.registrar-servers.com
thebeautyandabeet.com SOA 3600 MNAME: dns1.registrar-servers.com
RNAME: hostmaster.registrar-servers.com
Serial: 2019040202
Refresh: 43200
Retry: 3600
Expire: 604800
Minimum TTL: 3601
thebeautyandabeet.com MX 1800 Priority: 10
Target: eforward1.registrar-servers.com
thebeautyandabeet.com MX 1800 Priority: 10
Target: eforward2.registrar-servers.com
thebeautyandabeet.com MX 1800 Priority: 10
Target: eforward3.registrar-servers.com
thebeautyandabeet.com MX 1800 Priority: 15
Target: eforward4.registrar-servers.com
thebeautyandabeet.com MX 1800 Priority: 20
Target: eforward5.registrar-servers.com
thebeautyandabeet.com TXT 1800 TXT: v=spf1
include:spf.efwd.registrar-servers.com
~all

Full WHOIS Lookup

Domain Name: THEBEAUTYANDABEET.COM
Registry Domain ID: 2376106649_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2019-04-02T19:49:05Z
Creation Date: 2019-04-02T19:48:57Z
Registry Expiry Date: 2020-04-02T19:48:57Z
Registrar: NameCheap, Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DNS1.REGISTRAR-SERVERS.COM
Name Server: DNS2.REGISTRAR-SERVERS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-04-04T13:33:38Z